GenomeNet

>tva:TVAG_537410 K01176 alpha-amylase [EC:3.2.1.1] | (RefSeq) Alpha amylase, catalytic domain containing protein (A)
MLISFAVNGRFGAANQYDPLPNCNIHPQMSCAGSSGDIDPKWFGNLWNTPKRGKENWKPG
FQDMSDLTGYAQLKYASGRQSCTVNIITKTSKDLDLTFYFDGVAQKTNSKTFDSSFNKLL
KVKVVAATGESLILDDIDFVRNVAPLGQRSNDQRYRNGQKGAIIELFGWPDADIEQECKF
IADAGYLGVKVFPHQEQVMSSQTFEKELNPWYFMYQPVSYRLQGRMGTRDQLRNMINTCR
RYGVRVYADAVVNHMTGNGNDLSNHRNPSAGCTKWGNKTSSAYELGSPYYTPAYTYETNP
NTGRGTNVLEFPAVPYGPEDFHCDKALGSWSDPNILNTGWLSGLSDLDTSKDYVRQRIAD
FMIDLISIGFSGYRIDAAKHIHPKDLAAIFGKVKQGLGGSLPDDFISWLEVLTGGEAYLL
VQGDGDYSFTGGLTKFLKQNGLNDDEILKIKIWWCGYPTEPGNDNGSIDPHRKVIQNDDH
DQQNDGSSSRDMHDAGCVLVKGCDPAKHREYEKRLFKNPAGFESNNKDAAPIRLVLSSYY
WGDNNVHSIPDGESDCKKCTLSCESCHTREYIKAYNPSATSYPGGKGYTYVHRDSEIIQE
MNNWMNL

BLAST