GenomeNet

>tve:TRV_01706 aldose 1-epimerase family protein, putative; K01785 aldose 1-epimerase [EC:5.1.3.3] (A)
MCGVLRQLMLLPLAFLSITPSCSAWNFHHQLNGTTPSNGTPMNGSSSCPLANGASSNPLQ
VYTIAANNITASFIPYGARLISLMVPDREGKMQDVIVGYDDPQDYVKDTLTNHTYFGCIV
GRYANRIRNGTFVLDGTTYNTPKNELNKTQTLHGGSVGYDQRNWTVTALSDNSITFTLFD
SGYEHFPGDVINHVTFSVNSSYGLKRPNPQAEFTARTISLSLTKKTPIMLSPHIYWNLNA
FKNETVLEDTLLQLPLSRRYVEVDSRLIPTGNIGNVSSSLNGTLDFTKGKLIGKDIKSAD
GICGANCTGYDNCFIIDRPNNASDWTSSPQTMVPAVNMSSVTTGINMLVTTNQQAIQIYS
CNGQNGTIPVKSSQVARNKASGDGNGTVVDKIEQYGCLVIETEGWIDGINNPDWGQDPFQ
IYSPESGPAINWATKGLLQYWCRLIEAIKATRAVTKEGKVVPHKNNICKLFLVFCIKYYF

BLAST