GenomeNet

>tve:TRV_01706 K01785 aldose 1-epimerase [EC:5.1.3.3] | (RefSeq) aldose 1-epimerase family protein, putative (A)
MCGVLRQLMLLPLAFLSITPSCSAWNFHHQLNGTTPSNGTPMNGSSSCPLANGASSNPLQ
VYTIAANNITASFIPYGARLISLMVPDREGKMQDVIVGYDDPQDYVKDTLTNHTYFGCIV
GRYANRIRNGTFVLDGTTYNTPKNELNKTQTLHGGSVGYDQRNWTVTALSDNSITFTLFD
SGYEHFPGDVINHVTFSVNSSYGLKRPNPQAEFTARTISLSLTKKTPIMLSPHIYWNLNA
FKNETVLEDTLLQLPLSRRYVEVDSRLIPTGNIGNVSSSLNGTLDFTKGKLIGKDIKSAD
GICGANCTGYDNCFIIDRPNNASDWTSSPQTMVPAVNMSSVTTGINMLVTTNQQAIQIYS
CNGQNGTIPVKSSQVARNKASGDGNGTVVDKIEQYGCLVIETEGWIDGINNPDWGQDPFQ
IYSPESGPAINWATKGLLQYWCRLIEAIKATRAVTKEGKVVPHKNNICKLFLVFCIKYYF

BLAST