GenomeNet

>tve:TRV_03366 hypothetical protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MIRRLTQYTKQFQRPVTTLVNSNVKMAAPASDITLYTSQTPNGIKISIALEELGLPYKVV
AIELGQNTQKEPWFLEINPNGRIPAITDTFTDGKKIAIFESGSILEYLVDRYDTEHKISY
PKGTREAYEVSNWLFFQNAGLGPMQGQANHFNRYAPERIEYGVNRYTNETRRLYGVLDKH
LSQSKSGYLVGDHISIADISHWGWIASAGWAGVDIDDFPHLKAWEERLLKREGVEKGRHV
PKPHTIKELLKDKEAMEREAAKSRQWVQAGMKSDASK

BLAST