GenomeNet

>tve:TRV_03860 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) hypothetical protein (A)
MERPEEVRKERVVGFVEQADRASQVPGQKNNDDSRPKILDFKPPEELKAVFSEGLTSSGQ
GHDGLVRTVDDLLKYSVNTWQQGFLDKLYSSPNAPGLAAELLLGTLNANVHVYQSAPALT
VIEKVTTRRFAELFGLTGPNAGGISVQGGSASNTTAIVVARNTLFPDTKKNGTGDHRFVI
FTSAHGHYSIEKAAQMIGLGSNAVHCVPVDREGRMIPQKLDEEIQKAKDDGKTPLFVNAT
AGTTVLGTFDPFTEIAGICRKHKIWFHIDGAWGGAFIFSNRQKHKLEGSHMADSIAINPH
KMLGVPLTCSFLLGADMTQFHGSNTLPAGYLFHNDVSDGSEVWDLGDLTLQCGRRGDALK
MFLNWNYIGSSGYEERIDAASDVAVHLCNLISESPDLILLSENPPPCFQICFFYAPFKQM
VHSSDNVADEAERGKLNGEITSMIANDLIEQGFMVDYAPPAAAQVEGDGKYLRCVVNLHT
KKETVERLVEVVLQLGAKAVRKQRGLELNGDFVNSNQASVPGQRPKHPLEMGRGPQGAPA
ASDFVL

BLAST