GenomeNet

>tve:TRV_05012 hypothetical protein; K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MSFINVVRSDASTGNISNAYNWPSLCRFPQRIRFPAKLNKIISVSEQTQSRRREISRCPR
SSHLQLLLSSIDLAPLGQLVCSLLSHPLIADSIARFIPSRQISTMASAAVLSRRLLLSKT
AQHGLRESRNVLRLSDALSDIAYPPHTIISMPALSPTMTSGNIGAWNKKAGDTLSPGDVL
VEIETDKAQMDFEFQDEGVLAKILKDAGEKDVAVGNPIAVMVEEGEDISPFESFSLEDAG
GDKAPAADKSPKEAPKPEEAETKAAPTPTFEENKPEAREADTTGEKLQPSLDREPFVSPA
AKALALEKGVAIKDVKGTGPGGRVTKEDVEKHQASAPAAGAAGPAYEDVPASSMRKVIAS
RLAQSIRENPHYFVSSTLSVTRLLKLRQALNESSEGRYKLSVNDFLIKACAVALKRVPTV
NSRWIEQNGQVMIREHKTVDISVAVATPSGLITPIVKGVEGLGLSNISSQVKDLGKRAKE
NKLKPEEYNGGTFTISNMGMNPAIERFTAVINPPQSAILAVGTTRKVAVRSELEEGTEIE
WDDQIVVTGSFDHKVIDGAIGAEFMRELKRVVENPLELLL

BLAST