GenomeNet

>tve:TRV_05893 SET domain protein; K11429 histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43] (A)
MPRTPTVEKRERLTLSQLATYDDILTDTLVDHAFFWTTIRKNRTKYFPVRGINEDTITSI
LLHDVIVAKDVPKAEKQLLALPGLKKFTDRLLSDREREWFRRHLRKYISIYLPDCPFEVT
TTNRYTVLTHEAAVSARKFIPSGHPVKYLSGTLVSITKEEENDLDLTKRDFSIVMSTRKK
TASLFLGPARFANHDCNANAKLVTRGFESMEVVATQDIDIGDEITVSYGDNYFSEDNCEC
LCHSCEMAQRNGWSSPSASRVNSWVHSSSEFADASEHPPSSSNGCEKHELETDSESSDGF
LGKRRKVERKSSNLRLQESVDDTVGVDAKPNQGSPSPVTNTCSPLAGNAEESNDSTLPGG
NSTKNKCSTADIPLCDEEVSAACRASRDTSIENSSGQSSGSTAATSCPGSGDQAPLAPET
EDSTTNEPGKIEKIPELQLKPPFPQIILGDSETDLSDLSTVSEPVESEATNDAPRPKRKY
KKRGLPLPVVEEPPIFKEKLILQEKNVHVVNGILNYMDIDGPKLIRRVGVTKKNG

BLAST