GenomeNet

>tvi:Thivi_3115 ATP dependent DNA ligase-like protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MLLLLLKPPNGYATMPRFPFRLTSRWLLFLCLAAPPGFARDVVALPSQPVPTTKPALMLA
NVYTEGVDLSAYWVSEKLDGVRAYWDGARLISRGGHPIQSPEWFTAGFPAIPLDGELWMG
RGTFERLSGTVRRLEPAPDDWREIRFMVFDLPDLDAPFGQRLQRLQQVLADSANPSLVPV
EQVRIANHADLMARLDAVVQAGGEGLMLHRDGADYRAGRTDDLLKVKPYQDAEARVIEHL
PGQGKYAGMLGALLVEDANGLRFRLGTGFTDAERRAPPPLGSLVTYKYLGYTEKGIPRFA
SFLRVRAPE

BLAST