GenomeNet

>tvi:Thivi_3115 ATP dependent DNA ligase-like protein; K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] (A)
MLLLLLKPPNGYATMPRFPFRLTSRWLLFLCLAAPPGFARDVVALPSQPVPTTKPALMLA
NVYTEGVDLSAYWVSEKLDGVRAYWDGARLISRGGHPIQSPEWFTAGFPAIPLDGELWMG
RGTFERLSGTVRRLEPAPDDWREIRFMVFDLPDLDAPFGQRLQRLQQVLADSANPSLVPV
EQVRIANHADLMARLDAVVQAGGEGLMLHRDGADYRAGRTDDLLKVKPYQDAEARVIEHL
PGQGKYAGMLGALLVEDANGLRFRLGTGFTDAERRAPPPLGSLVTYKYLGYTEKGIPRFA
SFLRVRAPE

BLAST