GenomeNet

>tvi:Thivi_3125 ribulose 1,5-bisphosphate carboxylase, large subunit; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MTQNRTLSLSGERFTAVYHIVCKPAEAEARARDICVEQTIEFPEALVTDASIRDQIVGQV
LSLQAVGEARFEARIGYPVEAAGRELTQLINVLFGNISIKPGVRLVGFELPESLARQYRG
PRFGQAGLRALVDVHDRPLLCTAIKPMGLSPVALADLAYRLALGGIHLIKDDHGLSDQTF
CRYEERVRRCAEAVERANRETGQRCLYLPNVTAPAGEIASRARLAKDAGAGGLLFCPGLA
GFDAMRALADDDALALPILSHPAFQGTFCVHPDAGLSHGVLFGQLNRLAGADATIFPSWG
GRFSFTQAECRDLVAGATRPMGELRTIFPVPGGGMRLDRVAELSDFYGRDCILLIGGDLH
AHGPDLIESCRRFVAQAG

BLAST