GenomeNet

>tye:THEYE_A0546 no KO assigned | (RefSeq) ligD; DNA ligase D, 3'-phosphoesterase domain (A)
MPYFVVHEHHAKKLHFDLRLEKDGVLKSWAIPKGPSMNPQDKRLAIQVEDHALEYGNFEG
IIPEGQYGAGKVYIWDKGQYSTVKGSPEEGQWEIFMEGEILKGNFVLVKLKGKSDEWLFI
KKKDKFADYNFKLKLKFP

BLAST