GenomeNet

>tye:THEYE_A0546 ligD; DNA ligase D, 3'-phosphoesterase domain; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MPYFVVHEHHAKKLHFDLRLEKDGVLKSWAIPKGPSMNPQDKRLAIQVEDHALEYGNFEG
IIPEGQYGAGKVYIWDKGQYSTVKGSPEEGQWEIFMEGEILKGNFVLVKLKGKSDEWLFI
KKKDKFADYNFKLKLKFP

BLAST