GenomeNet

>uma:UM00400.1 hypothetical protein; K06101 histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43] (A)
MAPVRRLARASSSASVSSSPANLPTPTLSGPQLQSTSNAEPRISVHQTPTAAPRVLQHPS
TSPSKPHGSNSFDAPIILSDTETDNGTAGIVQHTGSSDDDMTAPHRTAGVDNGKAQRLSL
LFPAITDNHQDESRSSTTLDRSYATSLNSEVNLISDGSLSSLSSIDSDSDVTDDSDNKSI
AAAISSLRSTPRQTHNKTPALLSKRGTEATPEATASSSSSSSTPSRRSARIVSSGSSIQK
ALQRRDDLDAKLLASPLRRKPDSPEAPPPPRRAVGRPRKSVQPVPAQSSAARLSTSPAVL
PSSVQNLASPSSTRRSARLSLPFPMAPNSEYPASKDASQSPRREAELGPRPELRPGKHSR
KFAEASDKSKPVITLQPFSDSVTFSASVGSAISNGPVGNSPAVTSDAQSIPTLPVERSRG
RPRKSQPGLPTFPQTPAALTAEREQPALVTRLRKRNLSTAGMTAKSESLAVDEQQEDSDF
PPRKRGRPARSSTSATDRTAGEPLSTASGQTLHGRTPLRIDVIDLLDDDLSELSDASDMS
LNSSQPHQSASQSIQSGESHRQRPPQASTLPSKKLKRASKQNKDGKIYHYTGLYAGEADA
VASTSSLYPDASQSTLLPYPIHFGAKLLTEERDFCLPYPIHQTMDQLRDRVNAKRKPPRY
QQINKNKYVTRAKLQGEVPLCNCKPGSGCGHDCINRMLMFICDPKTCPSASNCTNISLGR
RPHVKTAVAYYGRRGFGLKTLEAIKRDDFIDEYRGEVINLSEAAKRVTEEYKATGNYYLL
DYDSAAGELLDGGRKGNITRFANHSCDPNCRIEKFIICGTDEALSAEFQIGLFANRDIAA
GEELTYNYGWAAFQPRDITGAPTAQVPTEQCLCGAANCSGILGGKKAPVSKSAADAVAAN
TRKKTGKGRGKRKSKGKVSKSTQSSRIHLTSMAPLLSASRLSAAAIPSSALSSVEAARNL
RKREDAQTRRNAISKITIKRRERSGRSAGDASSSTSASVTDSSVEPVTETWTKQISVPGG
KNGQQIPRSRAAKAVHATKSRQAPRDPISSFSQVIDLTGEHATPSPIEAISPKEASSTST
SVQFTGPTDADQAALGGDVLSSSASRVFPQLPLPKRINIKKPGGGFGAMAARGTKDRRWL
TAEAPSSDNDDSSSIRCDSAEYPSDILKEDDEAQLQDSSGKVPGKKRRGRHKLQLSAEEM
ARRAVERRARNAFLARKRRASKRGIVVMDPSHHPLKKISIQCTAAPENTYIPDLPSSLVT
LGMTIADARRARNAFLARVRRAIKRGFPKDAAIKMAAKPLPGDPERDTPVMKAQRAYMEQ
LEREAADEVTDSSQNGHGSSGSVSASNSSVAAEDDDWEDEPRWAAAL

BLAST