GenomeNet

>uma:UM01870.1 hypothetical protein (A)
MSKPAPGHKDAVYHTQCTGQALETVKTHSSPAEQTLFGACFCPFVHRVWIALEYLGVPYQ
YREVDPYKKLADLLELNPKGLVPALKLSNGKGLAESSVILEYIDEKYGGGKEGKSLLPPL
SNPYERAVYRLAVDKANRNLIPSFYRYLQAQEVEKQLEGAKEFTSHLSDFVRSMSSSGSV
GFWDGKALSIVDCTVAPWLYRATNVLRHFRGFEPEQLLEPDVMERWTKWRDAVFDLDAFK
ATTSTDDLYLDSYVRYAQNRPMTSQVAEAINKGRGLP

BLAST