GenomeNet

>ure:UREG_05063 K10777 DNA ligase 4 [EC:6.5.1.1] | (RefSeq) hypothetical protein (A)
MDGLNGPKGETEQELDEKYPNRPRNHHPTLPFHDLFLDLFNPLNENKKRPAGSTVARRKL
GPHGGQQTLSPQELRRDIIQRFISKWRNEVGDDIYPAFRLIIPEKDRDRAMYGLKEKTIG
KLLVKIMKIDKNSEDGFNLLNWKLPGQSMASRMAGDFAGRCYEVISKRPMRTEVGNMTVQ
EVNEKLDLLAAANKEDEQLPILEDFYRKMNPEELLWLIRIILRQMKVGATERTFFEIWHP
DAETLFSISSSLRRVCWELYNPNVRLEDEETGVTLMQCFQPQLAQFQMHSFQRMIEKMRL
SPEDPSFWIEEKMDGERMQLHMMSDDSITGGKRFKFWSRKAKDYTYLYGNGFYDENGALT
RHLKDAFADGVQNIILDGEMITWDPEQDAPVPFGTLKTAALSEQRNPFSATGQRPLFRAF
DILYLNDKALTRYTLRDRRKALEASIKPVHRRFEIHTYEVGYSAAHIEPQLRKVVAEASE
GLVLKNPDSPYRLNERHDDWMKVKPEYMTEFGESLDCVVIGGYYGSGKRGGALATFLCGL
RVDEAQIRQGANPMKCYSFCKVGGGFTAADYANVRHHTDSKWKDWDPKKPPTEFIELAGG
DAQYERPDVWIRPDESVVLCVKASSVTPSDQFRLGLTVRFPRFKRLRMDKTWESALSIQE
FMDLKSNAEREQKEKEFKIDNSRKRKPKRTTKKPLTIAGYDENKKAEFDVSDQIFTSKSD
SLVVMTDALEPEKKSKLELEKLIKANGGKIYQTNTAASNTICIAERRTVKVASIQKAAKE
NIVRPSWLLDCIKQNEADLGLPDLLLPLEPRHMYFTVKGQEQEISSNVDQYSDSYVRDTT
TKELTKLLASMPAISNLSASRISKIEDQMQSRHEQEGTFHDLPGWLFKNQVLYFSQSRSS
SDSKVSSSRLASNIARFAGASLVSKPDDKRVTHIILDKDSRSADVSALRSSISKRVGAGR
IPHIVTVEWINESWKAKTLLDEEQLLKGVHFEFRKVCIDAFYRSHISVS

BLAST