GenomeNet

>ure:UREG_06952 K01785 aldose 1-epimerase [EC:5.1.3.3] | (RefSeq) hypothetical protein (A)
MSPLEEKAAFRFLSLGAIVQEFRVAGHNIVLGFPTEQLYRKYNAPYFGATIGRTTNRLKD
ATIGNVNGRSYKVTTARGPHSLHGGRDGWNAKLFDGPNTVKKHDREGFEFKYLSRHGDEG
YPGTVELRVWYSATEEVEEGKPEKTVLEVDYEVEFVGDECEETVVGVTNHRKVDYPYYFN
LGECPTIEGTEAVLETDKYLPTDPEGIPTGTIEHYTATEVKKPFFLSETSPDIDDCFVMD
TDPSSIPLDTRTRPMKLLASFKHLTTGLHLEVHSTEPAFQFYTGKYINVPAVRGMPARGP
RSGFCVEPSRYVNAPNKPEWRVFAPSSPSEDEEQARKQTVNTSTSCTGPSFSSAGCKGLP
RRKRVLKPLIVRSSLSKIFAILVADAQFNPRRIQLFRRSYGQQDRTTLSRGSRSAEPNSA
RHSEPPVIHGSRDPPTPTMCRQLYNQHSCDHTIFVRTKTCGKKQYCPVISREPTRVHYIC
HRCAATILMSMRSDNQKAM

BLAST