GenomeNet

>uur:UU594 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase (A)
MAKVNAFSKKIGWIELITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQS
RTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVI
ISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVK
IGCQEFYSAVCRHHHKVPNRPYLNSNSEEFIKFFKNKKRNKNI

BLAST