GenomeNet

>val:VDBG_04895 succinate dehydrogenase iron-sulfur subunit; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MAALRSSSTRVLGSAVRPAFRPALFARTMATVNEPATTPEPKMKSFQIYRWNPDQPTEKP
RMQTYTLDLNKTGPMVLDALVRIKNEIDPTLTFRRSCREGICGSCAMNINGQNTLACLCR
IPTETPEMKIYPLPHTYVVKDLVPDLTQFYKQYKSIKPYLQRDTPSPDGKEYRQTKADRR
KLDGLYECILCACCSTSCPSYWWNSEEYLGPAILLQSYRWLADSRDERKGERKMALDNSM
SLYRCHTILNCTRACPKGLNPGLAIAEIKKQMSF

BLAST