GenomeNet

>van:VAA_01536 anaerobic glycerol-3-phosphate dehydrogenase electron transfer; K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] (A)
MMKYDVTIIGGGIAGYSAGLRCLQAGLKTALISQGQSALHFSSGSIDVLGKLPSGEAVES
PLLAMEALRQQAPNHPYSKIGADTILQGLMWFQKTLQQRGMPLTHQADNSNHYRITPMGT
LKATWLSQPYVYQHKTNADFKRIVLLAIDGYRDFQPHMLQDNLRALPAFSAIPSEIINIT
IPGFEALRHNPNELRSIDIARLLKQPHAWRSFCDQLIRHATVQDLVILPAIMGNGDGLTL
LNKLKLETNLQLHEVPTMPPSLMGIRIEETLSRAFLTMGGTHLKGDKVISGEFDGNRLTA
IHTQNLNDMPIQADHFVMATGSYFSQGLQASHHGISEPVFQLETESCHDRALWRNHAFFS
ANSHPFMTFGVLTNTSLNPTHQGNIITNLYCCGSMLAGYDPIFEGSGGGVAIASAYHATS
QIMAQTQSRPAIQEVLA

BLAST