GenomeNet

>vap:Vapar_0042 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase domain protein (A)
MKLYYSPGACSLSPHIALHEAGLAFEPVLASTKTHKLQDGTDYYGINPLGYVPMLELDDG
TRLREGPAIVQYIADLAPTKNLAPAAGTLQRYRLQEWLTFIGTEMHKGYSPLFNPNMPEE
AKAIFKDKLKSRYQWLDGQLADKQYLMGEQFSVADGYLFTVTNWAKSTGVDISGFANLQA
WHARVAARPAVQAAMKAEGLLK

BLAST