GenomeNet

>vap:Vapar_1945 RuBisCO-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MTVAERIRARYLIETPLDPAAVAEVMAGEQSCGTFTRVEGETDALRERARATVEAITELA
PAEAPSLPNAMLERKGTRGPWRRAHIDISFPVANIGANLPTLAATVSGNLYDLGEVTGLR
LESLQLPAAYRAQFEMPRAGIAGTRRITGVASGALVGTIIKPNVGLSAGETAELVARLCA
AGVDFIKDDEVCANPAHAPLAERVPAVMAVVRAHQQRTGKHVMVAFNITDETDAMKRHAD
LVEREGGSCVMASLNWCGHSGMQTLRRHTGLALHGHRNGYGALSRHPLLGISFQAYQTLW
RLAGVDHMHVHGLQGKFSQPDSEVIESARDCFTPLTDAADDRVMPAFSSGQWAGTVPATW
AAICSDDLLFMAGGGILAHPDGAAAGVTSIRQAWSAARAGTALQEAARGAPELARALAFF
GKP

BLAST