GenomeNet

>vce:Vch1786_II0436 K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] | (GenBank) glpC; sn-glycerol-3-phosphate dehydrogenase subunit C (EC:1.1.5.3) (A)
MNHAFIHSAPQNTTFDQCIKCTVCTVYCPVAKANPNYPGPKQCGPDGERLRIKSAEYYDD
ALKLCTNCKRCETACPSGVKIGDMIAVARGKYGKKPLNPKLVRDFVLSHTDLFGSIATPF
APLVNAATSLPLVKKLMHKTIGVHDHKTLPKYSHGTFRRWFKQNCTSQPLYQRQVAYFHG
CYVNYNHPQLGKDFVRVMNAMNIGVRLLDSEKCCGVPLIANGFHNKARKNALHNVKHLTA
MVNDYHAPVLSTSSTCSFTLQQEYPHVLGVDNSQVVDQIHYVTRFLLKEFMSGNAPKMKP
VHKKVVYHTPCHLERSGNVMFTIELLKMVPGLELVVLDSECCGLAGTYGFKEENYEVSKK
IGSHLFDAIQTSDADYAVTDCETCKWQIEENAHLETIHPVSLLAMALIDEPSA

BLAST