GenomeNet

>vch:VC1457 K10928 cholera enterotoxin subunit A [EC:2.4.2.36] | (RefSeq) cholera enterotoxin subunit A (A)
MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLY
DHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLG
AYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGY
GLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQI
FSGYQSDIDTHNRIKDEL

BLAST