GenomeNet

>vch:VCA0749 K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] | (RefSeq) glpC; sn-glycerol-3-phosphate dehydrogenase subunit C (A)
MNHAFIHSAPQNTTFDQCIKCTVCTVYCPVAKANPNYPGPKQCGPDGERLRIKSAEYYDD
ALKLCTNCKRCETACPSGVKIGDMIAVARGKYGKKPLNPKLVRDFVLSHTDLFGSIATPF
APLVNAATSLPLVKKLMHKTIGVHDHKTLPKYSHGTFRRWFKQNCTSQPLYQRQVAYFHG
CYVNYNHPQLGKDFVRVMNAMNIGVRLLDSEKCCGVPLIANGFHNKARKNALHNVKHLTA
MVNDYHAPVLSTSSTCSFTLQQEYPHVLGVDNSQVVDQIHYVTRFLLKEFMSGNAPKMKP
VHKKVVYHTPCHLERSGNVMFTIELLKMVPGLELVVLDSECCGLAGTYGFKEENYEVSKK
IGSHLFDAIQTSDADYAVTDCETCKWQIEENAHLETIHPVSLLAMALIDEPSA

BLAST