GenomeNet

>vci:O3Y_17028 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) glpA; sn-glycerol-3-phosphate dehydrogenase subunit A (A)
MTAYQRMETDVVIIGGGATGTGILRDCALRGLRCILVEKDDIAAGTTGRNHGLLHSGARY
AVTDSESARECIQENKILKSIARRCVEATDGLFITLPEDDLGFQESFIHACSDAGIETQR
LTPKEALLLEPNVNPALIGAVKVPDGTLDPFRLCAANVLDAKEHGARMFNRTIVTQLIRE
GDTVLGVRCQHLGSGAKFDIFAQQVINAAGIWGQNICEYADLNIKMFPAKGSLLILDYRI
NNLVINRCRKPSDADILVPGDTISLIGTTSEHIDYDQIDNLHVTEREVDILLAEGAKLAP
IMANTRVLRAYAGVRPLVAVDDDGSGRNISRGIVLLDHEQRDGLKGFTTITGGKLMTYRL
MAEWATDLVAKKLGNTQSCQTHLRPLPGSQQAPKALKKTASIAKPVYESAIYRHGERAAN
FLADDAKSQAVICECEMVTAGEIEYAIKQLDVNNLVDLRRRTRLGMGPCQGELCSYRAAS
LFSEYGQVSGCQSSHLLVDFLEERWKGIKPIFWGDALREAEFSYWIYEGLLGASDLPSFD
SATEKQQ

BLAST