GenomeNet

>vcj:VCD_000714 K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] | (GenBank) hypothetical protein (A)
MKTFDPLSSYSPTHWRSEGDINTTAARRDWLTHVNDETTQNLLQRDANVFLHQAMSTPCL
APLASAAGCYLYDVSGKSYLDFHGNNVHQLGHGHPQVIEKITEQMQTLPFAPRRFTHETA
IRCAEKLTEIAGGELNRVLFAPGGTSVIGMALKLARHITQNFKVVSLWDAFHGASLDAIS
VGGEACFRQGMGPLMAGVERIPPAITYRGAFPREDGSDVHYADYLEYVIEKEGGIGAFIA
EAVRNTDVQVPSRAYWQRVREICDKHNVLLIIDDIPNGMGRSGEWFTHQAFGIEPDILCI
GKGLGAGLIPIAALLTKEKYNTAAQVSLGHYTHEKSPLGCAAALATIEVIEQHNLLAKVH
ADSIYMRQRLSQMQQQFSLIGDVRGIGLLWGIELVIDRHTKQRAHDEAEAILYHCLRHGL
SFKVSQGNVIQLSPPLIISRQELDQALDILYSALLAISQQMNYSY

BLAST