GenomeNet

>vcn:VOLCADRAFT_63500 K01867 tryptophanyl-tRNA synthetase [EC:6.1.1.2] | (RefSeq) hypothetical protein (A)
MDDITAHIVSSHAFLFTHHFLSLVPFLVPLCFPSTPHPLTPPTPLRSKRILSGVQPTGRP
TLGNYLGAMKNWVALQEQYDNFFCVVDLHAITVPHDPRELRAATRSMAATYIAAGIDPDR
ATIFVQSHVPAHTELAWLLSCVTPVGWLGRMIQFKEKSRKQGEDVRTGLMTYPVLMAADI
LLYQADLVPVGEDQKQHLELTRDIAEKVNLEFGGKGWKKRGGRGGRVFKVPEVFLPPAGA
RIMSLQDGTAKMSKSAENDNSRINLTDSPEVIAAKIKRCKTDTVEGLEWGNTDRPEATNL
LAIYSLCTGKSKDEVVSECASMRWGTFKPLLADAIIEHLKPLQVKYGELMSDQSYIDAVL
AKGAEAASATADRTLADVRDAMGFVAPFRAPRS

BLAST