GenomeNet

>vcn:VOLCADRAFT_63500 hypothetical protein; K01867 tryptophanyl-tRNA synthetase [EC:6.1.1.2] (A)
MDDITAHIVSSHAFLFTHHFLSLVPFLVPLCFPSTPHPLTPPTPLRSKRILSGVQPTGRP
TLGNYLGAMKNWVALQEQYDNFFCVVDLHAITVPHDPRELRAATRSMAATYIAAGIDPDR
ATIFVQSHVPAHTELAWLLSCVTPVGWLGRMIQFKEKSRKQGEDVRTGLMTYPVLMAADI
LLYQADLVPVGEDQKQHLELTRDIAEKVNLEFGGKGWKKRGGRGGRVFKVPEVFLPPAGA
RIMSLQDGTAKMSKSAENDNSRINLTDSPEVIAAKIKRCKTDTVEGLEWGNTDRPEATNL
LAIYSLCTGKSKDEVVSECASMRWGTFKPLLADAIIEHLKPLQVKYGELMSDQSYIDAVL
AKGAEAASATADRTLADVRDAMGFVAPFRAPRS

BLAST