GenomeNet

>vcn:VOLCADRAFT_83349 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (RefSeq) rbcS; ribulose-bisphosphate carboxylase small subunit (A)
MAALLAKSSVAAAVARPQRSSVRPCAALKPAVKAAPVATPAQANKMMVWTPVNNKMFETF
SYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESTVRFGPVSCLYYDNRYWTM
WKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNVKQVQIMGFLVQRPKSARDWQPA
NKRSV

BLAST