GenomeNet

>vcn:VOLCADRAFT_96572 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (A)
MAAIVAKSSVAAVVARPARSSVRPVAGLKPAVKAAPVAAPAQANKMMVWTPVNNKMFETF
SYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESTVRFGPVSCLYYDNRYWTM
WKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNVKQVQIMGFLVQRPKSARDWQPA
NKRSV

BLAST