GenomeNet

>vco:VC0395_0686 glpA; sn-glycerol-3-phosphate dehydrogenase subunit A (EC:1.1.5.3); K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MTAYQRMETDVVIIGGGATGTGILRDCALRGLRCILVEKDDIAAGTTGRNHGLLHSGARY
AVTDSESARECIQENKILKSIARHCVEATDGLFITLPEDDLGFQESFIHACSDAGIETQR
LTPKEALLLEPNVNPALIGAVKVPDGTLDPFRLCAANVLDAKEHGARMFNRTIVTQLIRE
GDTVLGVRCQHLGSGAKFDIFAQQVINAAGIWGQNICEYADLNIKMFPAKGSLLILDYRI
NNLVINRCRKPSDADILVPGDTISLIGTTSEHIDYDQIDNLHVTEREVDILLAEGAKLAP
IMANTRVLRAYAGVRPLVAVDDDGSGRNISRGIVLLDHEQRDGLKGFTTITGGKLMTYRL
MAEWATDLVAKKLGNTQSCQTHLRPLPGSQEAPKTLKKTASIAKPVYESAIYRHGERAAS
FLADDAKSQAVICECEMVTAGEIEYAIKQLDVNNLVDLRRRTRLGMGPCQGELCSYRAAS
LFSEYGQVSGCQSSHLLVDFLEERWKGIKPIFWGDALREAEFSYWIYEGLLGASDLPSFD
SATEKQQ

BLAST