GenomeNet

>vco:VC0395_0686 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) glpA; anaerobic glycerol-3-phosphate dehydrogenase, subunit A (A)
MTAYQRMETDVVIIGGGATGTGILRDCALRGLRCILVEKDDIAAGTTGRNHGLLHSGARY
AVTDSESARECIQENKILKSIARHCVEATDGLFITLPEDDLGFQESFIHACSDAGIETQR
LTPKEALLLEPNVNPALIGAVKVPDGTLDPFRLCAANVLDAKEHGARMFNRTIVTQLIRE
GDTVLGVRCQHLGSGAKFDIFAQQVINAAGIWGQNICEYADLNIKMFPAKGSLLILDYRI
NNLVINRCRKPSDADILVPGDTISLIGTTSEHIDYDQIDNLHVTEREVDILLAEGAKLAP
IMANTRVLRAYAGVRPLVAVDDDGSGRNISRGIVLLDHEQRDGLKGFTTITGGKLMTYRL
MAEWATDLVAKKLGNTQSCQTHLRPLPGSQEAPKTLKKTASIAKPVYESAIYRHGERAAS
FLADDAKSQAVICECEMVTAGEIEYAIKQLDVNNLVDLRRRTRLGMGPCQGELCSYRAAS
LFSEYGQVSGCQSSHLLVDFLEERWKGIKPIFWGDALREAEFSYWIYEGLLGASDLPSFD
SATEKQQ

BLAST