GenomeNet

>vcr:VC395_1233 tdk; thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQMYFYYSAMNAGKSTTLLQSAFNYQERGMNPLIFTAAIDDRFGVGKVSSRIGLEAEAH
LFHADTDLLHVIATLHEAEPRHCILMDECQFLSKEQVYQLTEVVDKLDIPVLCYGLRTDF
LGELFEGSKYLLSWADKLIELKTICHCGRKANMVIRTDEHGNAISEGDQVAIGGNDKYVS
VCRQHYKEALGR

BLAST