GenomeNet

>vej:VEJY3_14160 K02358 elongation factor Tu | (GenBank) protein translation elongation factor Tu (EF-TU) (A)
MSKAKFERVKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGGEAKDFASIDNAPEERERG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDLPVIQGSALGALN
GEEQWEAKIVELAEALDSYIPEPERAVDLPFLMPIEDVFSIQGRGTVVTGRIERGILNVG
DEVAIVGIKDTITTTCTGVEMFRKLLDEGRAGENVGALLRGTKRDEVERGQVLAKPGSIT
PHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDITLPEGVEMVMPGDNVQMT
VELIAPIAMDEGLRFAIREGGRTVGAGVVAKIFD

BLAST