GenomeNet

>vej:VEJY3_14160 protein translation elongation factor Tu (EF-TU); K02358 elongation factor Tu (A)
MSKAKFERVKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGGEAKDFASIDNAPEERERG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDLPVIQGSALGALN
GEEQWEAKIVELAEALDSYIPEPERAVDLPFLMPIEDVFSIQGRGTVVTGRIERGILNVG
DEVAIVGIKDTITTTCTGVEMFRKLLDEGRAGENVGALLRGTKRDEVERGQVLAKPGSIT
PHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDITLPEGVEMVMPGDNVQMT
VELIAPIAMDEGLRFAIREGGRTVGAGVVAKIFD

BLAST