GenomeNet

>vej:VEJY3_20336 branched-chain alpha-keto acid dehydrogenase subunit E2; K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MKTFNLPDLGEGLAESEIVKWHVNVGDMVEVDQVILTVETAKATVDVPAPYSGRVVSRHG
EEGDIVNIGALLLEIDESGAEHHVSAEKRQTADAATVVGNVSHQTQNVNVDDFWVGSSDG
TSNNNLITALPSARLLAKKLGVDLNAVSGSGPNGLIIDSDIYDEAGKQRPGTEVLKGARR
TMVSAMAESHKNVAAVTITEEALLENWASGEDISIRLVQAIVHACQEEPALNAWFDEETM
TRCVHTTVNLGVAVDSRHGLYVPVLRHADEYESKDVRRWLDQTVEGIRERKINREDLQHA
TITLSNFGAIGGIFATPVVSPPQVAIVGAGRIIERVVIRNGKAVAVKVMPLSITFDHRAC
TGGEAARFTKVLAEHLQRPSGN

BLAST