GenomeNet

>vfi:VF_0912 yeaD; hypothetical protein; K01792 glucose-6-phosphate 1-epimerase [EC:5.1.3.15] (A)
MNLTQLPIISVLSDNVTVAQLDDVKVIRVIHDKANAAISLHGGHVLSFTPKGQDDLIWMS
KEAIFNPEKAIRGGVPVCWPWFGRIADPAHGFARNNEWTLIEHRENDNGVIIVLGLEASE
ATKAIWPFEFEARLTVEIGDELRITLDAKNTDSKAWNCSGALHTYLNVADIASTTITGMG
PTYIDGLQNAKLCTGEDTLSISAAVDRVYTQPENTVSVSDSQRTLTVTNSGHNAAVIWNP
WIEGAESMADMNNDGYKTMVCVESTYHATSLEEAQTVEPGNAFTLTTTIKA

BLAST