GenomeNet

>vfi:VF_0912 K01792 glucose-6-phosphate 1-epimerase [EC:5.1.3.15] | (RefSeq) yeaD; hypothetical protein (A)
MNLTQLPIISVLSDNVTVAQLDDVKVIRVIHDKANAAISLHGGHVLSFTPKGQDDLIWMS
KEAIFNPEKAIRGGVPVCWPWFGRIADPAHGFARNNEWTLIEHRENDNGVIIVLGLEASE
ATKAIWPFEFEARLTVEIGDELRITLDAKNTDSKAWNCSGALHTYLNVADIASTTITGMG
PTYIDGLQNAKLCTGEDTLSISAAVDRVYTQPENTVSVSDSQRTLTVTNSGHNAAVIWNP
WIEGAESMADMNNDGYKTMVCVESTYHATSLEEAQTVEPGNAFTLTTTIKA

BLAST