GenomeNet

>vfu:vfu_B00415 anaerobic glycerol-3-phosphate dehydrogenase, subunit C; K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] (A)
MNAPFSKAAPLNTSFDQCIKCTVCTVYCPVAKANPDYPGPKQCGPDGERLRIKNPEYYDE
ALKYCTNCKRCETACPSGVKIGDIIAVARGKHGKKPLNPKLMRDYVLSHTDLFGSLATPF
APVVNFATSMPLVKKIMHKTIGVHDHKALPKYSHGTFRRWFKQNCTSQPLYQRQVTYFHG
CYVNYNHPQLGKDLVKVLNAMNIGVRLLNNEKCCGVPLIANGFHDKARKNALLNVKNMET
AVHEYHTKVI

BLAST