GenomeNet

>vfu:vfu_B00415 K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] | (GenBank) anaerobic glycerol-3-phosphate dehydrogenase, subunit C (A)
MNAPFSKAAPLNTSFDQCIKCTVCTVYCPVAKANPDYPGPKQCGPDGERLRIKNPEYYDE
ALKYCTNCKRCETACPSGVKIGDIIAVARGKHGKKPLNPKLMRDYVLSHTDLFGSLATPF
APVVNFATSMPLVKKIMHKTIGVHDHKALPKYSHGTFRRWFKQNCTSQPLYQRQVTYFHG
CYVNYNHPQLGKDLVKVLNAMNIGVRLLNNEKCCGVPLIANGFHDKARKNALLNVKNMET
AVHEYHTKVI

BLAST