GenomeNet

>vha:VIBHAR_02632 K01580 glutamate decarboxylase [EC:4.1.1.15] | (GenBank) hypothetical protein (A)
MVKEQKTADVSFESLLKIFTIPEGPDSTLTKIDESLSQNLNQFLREHIVAEEKPLHEIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQDDKFYAKWMHSAKHSLGAFCSGGTIANITA
LWVARNKALKANGAFKGVEKEGLFKAMKHYGYEGLAILVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIIVDDLKVKIAELEAQNIKPIAVVGVAGTTETGSVDPLAQIAEVCAEHN
CHFHVDAAWGGATLMSNHHRHLLDGVELADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIAKARYFADL
INQQEDFELVSEPELCLLTYRYLPTHMRAALEKAQGTQKEKLNELLNQLTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTNDILNAVLDEQREIALQAPSLMAKIEE
TVEDILNS

BLAST