GenomeNet

>vma:VAB18032_06515 DNA polymerase LigD ligase subunit; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MTGQLPVGAGWAYEFKWDGVRALADITAGRQHLYARSGVEITAAYPELITLAEQVDDALL
DGEVVLFDQAGRPSFTALAERMHVRDRAKAARLAASVPVTYMIFDLLRLRGEDLTGWPYA
RRREALDDLGLGAARWAVPPVFFDGAATYSAAGEHGLEGVMAKRVDSTYRPGVRSPDWVK
VKLEVTGDFVVGGWRPGARRIGGLLVGVPGAGGRLTYRGRVGGGIGAAIERELLRELEPL
RTPTSPFAAGVPREDARGAIWVTPQVVVEVKYGQRTPDGRLRFPRILRLRPDKPAEEVDD
AS

BLAST