GenomeNet

>vma:VAB18032_06520 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA polymerase ligd, polymerase domain protein (A)
MPAERFRVEVEGRTLDLSNLDKVLYPQAGFTKGEVIDYYTRIAPVLLPHLADRALTRIRY
PNGVDGNSFFEKNAPAATPSWVRTENLPAPGSSKGRETIDYVVADDLPTLVWLANLAALE
LHTPQWKVGEHPDLMVVDLDPGAPASLKQCCQVALLLRDRLAADGVDAYPKTSGKKGMQL
SCPIAGTQSSDDVSGYARRIAQELEREHPKLIVSKMAKNLRPGKIFIDWSQNNAAKTTVA
PYSLRAQPVPSVSAPLTWDEVAAGAAGKRPSSRPYTAGEVLKRVDEHGDLLAPLLDLGPA
LPER

BLAST