GenomeNet

>vma:VAB18032_12780 no KO assigned | (GenBank) DNA primase, small subunit (A)
MAGTKAAAEEIEVAGHTVRLSSPDRVIFPKRGFTKADVFGYYLGVGDGIMRALRERPTTL
QRFPDGIEGEMFFSKRVPTRGVPPWVRTTEITFPSGRTAAELCPVDLAHVAWAAQMGTVV
FHPWPVRAAEPDRPDELRVDLDPQPGTDFAHAATAAGELHVILDELGVPGWPKTSGGRGV
HVYLRIQPRWSFVEVRRATIALARELARRRPDLVTTAWWKEERGERVFVDYNQMARDRTI
ACAYSLRANARATVSTPVTWDELPDVDPDDFDLRTVPQRLAEQGDPHAGIDDAGWDITPL
LEWAERDAAAGEGDLPYPPDHPKMPGEPKRVQPSRDRDRPR

BLAST