GenomeNet

>vma:VAB18032_23715 DNA primase small subunit (A)
MASTAEEIQVGRRTVRVSSPDKPYFPERGLTKLDVVRYFLAVGDGILRALRDRPTMLERW
PRGVFEGATIATRQDNRGDAFYQKRVPSGAPGWVGTAHITFPSGRTADEVAPGELAVVIW
AVNLGTLRFHPWPVTRADVERPDQLRIDLDPMPGVGFDQVVPVAHEVHRFLDELGLTGYP
KTTGGRGLHVYVPIEPRWSFGDCRRAVLALGCELQRRRPDLVTTTWWREQRDRPVFIDYN
QMARDHTMASAYSIRPTPQALVSAPLDWAELDDVRPEDFDVVSMPARFAERGDPHAGLDE
DRFSLDPLLALADREGLAAPPER

BLAST