GenomeNet

>vma:VAB18032_25235 K16150 glycogen synthase [EC:2.4.1.11] | (GenBank) group 1 glycosyl transferase protein (A)
MSTNADVIDINPVRPQRVLMLSWEYPPVLVGGLGRHVHALSVALAAAGHEVTVVTRHADG
APLSERRDGVRILRAAEDPVTFPLATGSLLAWTMAFNHTLTRAALHATDTAEFDVIHAHD
WLVAHTAITLAEHLHLPLVTTMHATEAGRHQGWLPEEMNRTIHGVEHWLSNASTRLIACS
GYMRDQVTTLFEVPEEKVAVVPNGVDDRAWRARPRAVASARARFAGDGPLIGYAGRLVYE
KGVQHLVDAVPQLRDRHPGLRVLIAGDGPYRGELEERTRQLGLGGTVRFAGFLDNTQLPA
VLGATDATVVPSLYEPFGMVALEAAAAGAPLAVARTGGLAEIVEPGVTGVTFPHSDPPAL
AGAVGQLIGDEVFARRVARQARSMVGRRYGWATIAARTAHAYAVARREHAPAQARRPAVD
LPAPRRPITIPHGNLLVGTAAC

BLAST