GenomeNet

>vma:VAB18032_25235 group 1 glycosyl transferase protein; K16150 glycogen(starch) synthase [EC:2.4.1.11] (A)
MSTNADVIDINPVRPQRVLMLSWEYPPVLVGGLGRHVHALSVALAAAGHEVTVVTRHADG
APLSERRDGVRILRAAEDPVTFPLATGSLLAWTMAFNHTLTRAALHATDTAEFDVIHAHD
WLVAHTAITLAEHLHLPLVTTMHATEAGRHQGWLPEEMNRTIHGVEHWLSNASTRLIACS
GYMRDQVTTLFEVPEEKVAVVPNGVDDRAWRARPRAVASARARFAGDGPLIGYAGRLVYE
KGVQHLVDAVPQLRDRHPGLRVLIAGDGPYRGELEERTRQLGLGGTVRFAGFLDNTQLPA
VLGATDATVVPSLYEPFGMVALEAAAAGAPLAVARTGGLAEIVEPGVTGVTFPHSDPPAL
AGAVGQLIGDEVFARRVARQARSMVGRRYGWATIAARTAHAYAVARREHAPAQARRPAVD
LPAPRRPITIPHGNLLVGTAAC

BLAST