GenomeNet

>vma:VAB18032_27951 alpha amylase domain-containing protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MRVPRPRAAIPAALAATLVAASLTVVATTTAPASAAEVRANGDAIVHLFQWRWDSIAEEC
ETNLGPNGWGGVQVSPPQEHVVLPSAEGATYPWWQDYQPVSYRLDATRRGSKAQFVDMVE
RCRAQGVKIYVDMVLNHMSGTGSANSGPGSAGTVYSKYSYPNLFNDGSGDSYGYADFGPC
YRKINNWGNKQEVQDCELLDLADLNTADPEVRRKIAKYMNAVIDLGVAGFRVDAAKHVQE
SHLADIINRLRDVPGFGGRPDLFHEVYGDGTIPYTAYAPYGGVTNFDYQRSVSSAFRDGN
IAQLGNLPNYGGLTGQQAVVFIDNHDTQRETPTLTYKNGARYYLADTFMMAHPYGRPQLM
SSYAFGSVHGQGPPSASNGTTLATDCTSSAWICEHRDAGVAGMPGFRNAVAGTGIASVVT
DGNGRLAFARGNRGYAAFNATGSTWSRSFSTSLPDGRYCNVGRGAYDRSTGACPGGAVTV
SGGSFSAAIPADQAVALHVEARLDGPTPTASPTVTPTASPTASPTPTASPTQPAGSTRFT
ATVTTNPGQEVYVVGSIPQLGSWNPANGVKLSTTSGSYPTWSGAVDVPAGTAFEWKLVKV
GNGVQWENDPNRTGTGGTAFTVTWNQPATNPPGEATVSFQATASTTYGQHIYVVGDLPAL
GGWDPAKGVRLSPTAYPVWTGQLSLPAGTAFSYKYVKRTDSGQVVWESGTNRTATASGSV
TLTDTWR

BLAST