GenomeNet

>vmo:VMUT_0349 pyruvate:ferredoxin oxidoreductase subunit alpha; K00169 pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1] (A)
MEIAKTLSIREEIVKERVGLTSNYAAAYAVKAVDVDVIAAYPITPQTTIIEKLAELVANG
EIDAEYIPVESEHSALSAVVGAAAAGARVFTATSAQGLEFMHEVLHIASGLRLPIVMAVP
GRALSAPISIHGDYQDIMNAKDSGWIMLIASTAQEVYDSIIMAYRIAEDNRVLVPVMVSY
DGFLMSHTTEPVELYHEDYVRKFTPRNLNRLKLDPRKPITIGVIASPDWYYEIKYQVVNA
LKESRGVIKEIHGEFNKTFGTNYDIVERYMLDDADYVLITYGGASSGNAKEAVRRARERG
LRAGVLRIRLFRPFPVDEVVSSIKDAKMVAVVDRALSPGSTYEGPVFNDVVTALYSKGIE
KPVISVVHGISQRTMLADDFYNLYKTLDEYARTGEYPRKTIFLGLRG

BLAST