GenomeNet

>vmo:VMUT_0349 K00169 pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1] | (GenBank) Pyruvate:ferredoxin oxidoreductase (POR), alpha subunit (A)
MEIAKTLSIREEIVKERVGLTSNYAAAYAVKAVDVDVIAAYPITPQTTIIEKLAELVANG
EIDAEYIPVESEHSALSAVVGAAAAGARVFTATSAQGLEFMHEVLHIASGLRLPIVMAVP
GRALSAPISIHGDYQDIMNAKDSGWIMLIASTAQEVYDSIIMAYRIAEDNRVLVPVMVSY
DGFLMSHTTEPVELYHEDYVRKFTPRNLNRLKLDPRKPITIGVIASPDWYYEIKYQVVNA
LKESRGVIKEIHGEFNKTFGTNYDIVERYMLDDADYVLITYGGASSGNAKEAVRRARERG
LRAGVLRIRLFRPFPVDEVVSSIKDAKMVAVVDRALSPGSTYEGPVFNDVVTALYSKGIE
KPVISVVHGISQRTMLADDFYNLYKTLDEYARTGEYPRKTIFLGLRG

BLAST