GenomeNet

>vok:COSY_0462 riboflavin synthase subunit alpha (EC:2.5.1.9); K00793 riboflavin synthase [EC:2.5.1.9] (A)
MFTGIIQAIGKIKSIELGSFCFQAKKSFFDEVKIGDSIAVNGVCLTTIKIDDNYFKVDIS
KETLRCTIFSHLGVDSLVNLEKTLRLNQGIDGHLVSGHVDGIVKVVGRSIEGKSIRFKMK
TPKNLIKYITKKGSICINGVSLTVNNINDCVLDINIVPYTLKTTTLGELEINSKANLEVD
IIARHIERLLYFEKNSYEIYH

BLAST