GenomeNet

>vpe:Varpa_1915 Glutathione S-transferase domain; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MTTHIYSGPLSMFGAKVEIAAREKGVAFDLVMVPFTKDDAYEPKHPEVLRVNAVKQQVPV
LVDDAVALFDSTQIFEYLEDRYPTPALWPEGIADRARARQLEQKADEVFFPNVIKLFGLQ
NDMQSAPAVAACAACARYYAEMEGLLAGREYLAGPYSFADIAFYMACIFADRKGAGMTDA
TPRLIAWRNRVRDRPAVHAVVDPMMKFLASEGREVPAFLQR

BLAST