GenomeNet

>vpo:Kpol_1029p21 hypothetical protein; K01556 kynureninase [EC:3.7.1.3] (A)
MGIPVNSENVNDETEGDVAGKEVYYLCGNSLGLMPKDTKETVTRELDAWRDRAVESHFKH
PTDTSWVDIDLPVVPLLAPIVGGKNEEVAVMNTLTANLNSLLVSFYRPTKKRFKIVFEKK
AFPSDYYAFYNQCRLHNFDPNECILQISARPNETFLRTEDILKVIEENNESIALVCLPGI
QYYSGQLFEIERITKFAHQYPEIIVGWDLAHAVGNVPLKLHDWGVDFACWCSYKYLNSGP
GSIGGLFIHEKWHHSALKFGDDVNHDEYRPRLAGWWGNNNEKRFQMLEKFEPIKGALGFR
QSNPSVLDVVCLQSSLKIFQKYGGVENLRLKSLKLTKYLINQLQKSPYYHPKKQSSKEEL
GFRIITPIQNESQYGAQISIQLTPSRLTGKNKDTMEIVFEYMHRHGVVVDERKPNVIRIS
PVPLYNTFQDVFTTVAILNSALDSVKKSIKALKSN

BLAST