GenomeNet

>vpo:Kpol_1055p78 K00031 isocitrate dehydrogenase [EC:1.1.1.42] | (RefSeq) hypothetical protein (A)
MSRAYSSAARKLSKITVKSPLVELDGDEMTRIIWSKIKKNLILPFLDVDLKYYDLSIENR
DSTNDQVTVDAANAIKNFGVGVKCATITPDEARVEEFNLKKMWKSPNGTIRNILGGTVFR
EPIVIPRIPRLIPGWEKPIIIGRHAHGDQYKATDTLIPTAGKLELVFTPTDPNGERQILN
VYDYKNSGVALAMYNTDESIRGFAHSSFKLAINKKLNLFLSTKNTILKKYDGRFKDIFQE
IYESDYKSQFENLGISYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGFGSLG
LMTSVLVTPDGKTFESEAAHGTVTRHYRQYEQGKETSTNSIASIFAWSRGLAKRGELDST
PDVIKFANLLESATLNTVQQDGIMTKDLALACGKTERSAYVTTDEFLDAVATRLNNEFKS
FENSSKL

BLAST