GenomeNet

>vpo:Kpol_1070p4 hypothetical protein; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MLKSVGINISKRNFSQNVISLQKLKTFQIYRWNPDTPSVKPRLQTYQVDLDNCGPMVLDA
LLKIKDEQDPTLTFRRSCREGICGSCAMNIGGINTLACICKIDTNTSKKQKIYPLPHMYV
VKDLVPDLTNFYQQYKSIKPYLQRKEFPKDGKEILQSQEDRAKLDGLYECILCACCSTSC
PSYWWNQEEYLGPSVLMQAYRWLLDSRDEAGASRKEMLDNSMSLYRCHTIMNCTKTCPKG
LNPGVAIAEIKKMLAFEQ

BLAST