GenomeNet

>vpo:Kpol_376p15 K11482 histone deacetylase HOS1 [EC:3.5.1.98] | (RefSeq) hypothetical protein (A)
MQYKLVISTSRFQSQVADLLPCNKYKKSQLTYSLLVSYGLLDGFDVIIDDPCCNKKDLLQ
FHSRDYIDLLLDPVYNRIIQYDDDESKWSQLHPYIRDWLDSHPEEVPTSGMIEKRAGLLE
FYKKYNRFKKKRSISEAFSESESESESGSGSGSEANEYFQINNSRERQQDVYKKFNLEGD
CPLFSFLPLYCEVISGASLMLSDFIEKSSSQRTIAINWDGGRHHAIKNKASGFCYINDIV
ILIQKLRKKGISKVSYIDFDLHHGDGVEKAFRYSSNIQTISMHMYEPGFFPCTGSLEDTL
NGKNIVNVPLYHGVDDNYMTEIVNELIKPLIERHSPEVLVIQCGGDGLIGDKFEEWQLTI
SGLTRNIQNLIEWFPKSDIILLGGGGYNELVMSRFYTYLTYQIVKKYGSKPIIDLCIPRR
TITNASDKEEFNSDREDEDEDGDGDGDVLLPEHEFIELYSKEFYKFWVYELESSNKRKTL
KNYNDARYLDKLLKFYGMSKPKTDNCSSEINFRGKREE

BLAST