GenomeNet

>vpo:Kpol_507p3 hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MVHLGPKKPPMRKGSMADVPKELLDQIADFEKIYDTPAPVLKAIVKHFTSELDKGLSKKG
GNIPMIPGWVMDYPTGKESGDYLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYRLPDAMRT
TQDPEELWEFIADSLEAFVNEQFPEGCTKPLPLGFTFSFPASQDKINEGILQRWTKGFDI
PETEGKDVVKMLQKQLEKRNIPIRVVALINDTTGTLVASLYTDGETKMGVIFGTGVNGAY
YDVISGVEKLQGRLPADITADTPMAINCEYGSFDNEHVVLPRNRHDIIIDEESPRPGQQA
FEKMSSGYYLGELLRLAILEMVDNGHILKGQDCSKLRKPYIMDTSFPSRIEDDPFENLEN
TDELLSKTLGLSTTVQERKLIRRVSELIGTRSARIAACGIAGICQKRGYDTAHIAADGSV
YNLYPGFKERAAAALRDIYDWKEDKPENYPIVIVPAEDGSGAGAAIIAALTEKRLAAGKS
VGVLGA

BLAST