GenomeNet

>vvi:100244487 succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial-like; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MLKRWIRHGYKKVAGLFSKADTRTKRFPVLEGHPLAQEHAEAAVETQGTIQENLNALKKE
FQIYRWNPDFPNTKPHLQSYFVDLSTCGPMVLDALQKIKAEEDSSLSYRRSCREGICGSC
AMNIDGTNTVACLRPIDADTTKPTTITPLPHMFAIKDLWINVMTYIHACIYRSIEPWLKA
RQRPEDGREYRQSPKDRKKLDGLYECILCACCSTSCPSYWWNPEEFPGPAALLHAYRWVC
DSRDDFVDERVQALTEGLKSLYRCRTIKNCTVNCPKSLDPANAIHKMKTRHLVSQPVELF
EGQ

BLAST