GenomeNet

>vvi:100254718 succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MWRCVSRGLRFRSSDSKRSLTSEYLKPHISRFFSTESTGGGSSGTSEAEIKAAIGELSKH
GVDTAGITELYRSSYTSSYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPT
RSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENY
GLPFSRTEDGRIYQRAFGGQSLNFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFF
VEYFALDLLMDNDGACQGVIALNMEDGTLHRFQAASTILATGGYGRTYFSATSAHTCTGD
GNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAK
DLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDV
TKEPIPVLPTVHYNMGGIPTNYHGEVLTIKGNDPDAVVPGLMAAGEAACASVHGANRLGA
NSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDSGEKTIAWLDKLRNSNGSIPTSKIRLN
MQRVMQNNAAVFRTQETLEEGCKLIDKAWESFHDVQLKDRSLIWNSDLSETIELENLLIN
ACITMHSAEARKESRGAHAREDFTKRDDENWIRHTLGYWENEKVRLDYRPVHMNPLDDEI
ESIPPKARVY

BLAST