GenomeNet

>vvi:100260869 K13153 U11/U12 small nuclear ribonucleoprotein 25 kDa protein | (RefSeq) uncharacterized LOC100260869 (A)
MATPVKVYGPPMSTAVSRVLACLLEKDVNFQLIPVDMSKGEHKKPDYLKIQPFGQVPSFQ
DESISLFESRAICRYVSEKYANQGNKRLYGTNPLEKASIEQWLEAEGQSFNPPSSALVFQ
LAFAPRMKLKQDLGVINEMESSGGGKREEEDVGSYNSNNVKKARLHSTLTALLDDPILAD
VPKEPTLSDVDTLINLELGSAMRISVIKLDSTSFDVAVLNSATVKDLKLAIKKKINDMEQ
SKMGHRHISWKHVWANFCLSYYNDKLINDGSALQDFGIHNNSQVHFVPFIMSKGSQRHSR
RRKHRFFHGLNKRI

BLAST